PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG080500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 474aa    MW: 50730.7 Da    PI: 7.5671
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG080500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.9e-2495138245
                  WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Pavir.2KG080500.2.p  95 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 138
                          69***************************************986 PP

2QLQ59.41e-202763137
                  QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                         ++FT++Q+ +L++Q+l+yKyLaan P+Pp Ll++i++
  Pavir.2KG080500.2.p 27 GPFTPSQWIELEHQALIYKYLAANSPIPPSLLVPIRR 63
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-122763IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-152862IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.5032863IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.6594138IPR014977WRC domain
PfamPF088793.7E-2096137IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MNLCSLSGLS SVSLCSSMQG AMARVRGPFT PSQWIELEHQ ALIYKYLAAN SPIPPSLLVP  60
IRRSIASSPY PPSYFGTSTL GWGSFQLGYS GNADLEPGRC RRTDGKKWRC SRDAVADQKY  120
CERHMNRGRH RSRKHVEGQP GHAAKAMSAA VAAAAATQPP ALAASGAGAS AAGLTVSQHQ  180
QPVKSYSAGA TDPCSLQYNR ELVNKQNESD NMQDSDNLSM LTSMSTRNPG SLFPFSKQNN  240
PFEVTSSRLE FGLVSSDSLM SSPHSSLEHV NLLSSQSLNE NQSSASLQHF VDWPRTPAQG  300
GLSWADAEDM QAQRSQLSIS APMASSELSS ASTSPIHEKL MLSPLKLSRE YSPIGLSIAA  360
SRDEVSQLEA NWATMFRDSS MGGPLGEVLT KNGNGEARNC LRAPLNLLTD CWDSSPGMES  420
SPVGVLQKTT FGSVSSSTGS SPRMENHGAY DGISNLRDDL GSIVVNHPSI RLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.59860.0callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLK4A7G60.0K4A7G6_SETIT; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-49growth-regulating factor 2